General Information

  • ID:  hor002380
  • Uniprot ID:  Q99MP5(50-127)
  • Protein name:  Motilin-associated peptide
  • Gene name:  MLN
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  Motilin family
  • Source:  animal
  • Expression:  Present in the gut mucosa with the exception of the gastric corpus. Also present in medulla oblongata, nucleus of the solitary tract, hypophysis, spinal cord, hypothalamus, and cerebellum but not in the cerebral cortex.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SLRVQQRSKAAGRLEPQEVMEEEENGVIKLTAPVEIGVGLSSRQLEKHRAVLEALLSEALPPPSLVFGGQRPVTAAWE
  • Length:  78(50-127)
  • Propeptide:  MLSRKAVAALLLVHVTAMLASQTEGFVPIFTYSELRRTQEREQNKRLRKSLRVQQRSKAAGRLEPQEVMEEEENGVIKLTAPVEIGVGLSSRQLEKHRAVLEALLSEALPPPSLVFGGQRPVTAAWE
  • Signal peptide:  MLSRKAVAALLLVHVTAMLASQTEG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q99MP5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002380_AF2.pdbhor002380_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 985932 Formula: C373H616N108O115S
Absent amino acids: CDY Common amino acids: EL
pI: 5.1 Basic residues: 10
Polar residues: 15 Hydrophobic residues: 30
Hydrophobicity: -26.67 Boman Index: -12648
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 100
Instability Index: 6779.1 Extinction Coefficient cystines: 5500
Absorbance 280nm: 71.43

Literature

  • PubMed ID:  NA
  • Title:  NA