HORDB

ID: hor002380
Uniprot ID: Q99MP5
Protein name: Motilin-associated peptide
Gene name: MLN
Organism: Cavia porcellus (Guinea pig)
Family: Motilin family
Source: Animal
Expression: Present in the gut mucosa with the exception of the gastric corpus. Also present in medulla oblongata, nucleus of the solitary tract, hypophysis, spinal cord, hypothalamus, and cerebellum but not in the cerebral cortex.
Disease: NA
Comments: NA
Taxonomy: Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: SLRVQQRSKAAGRLEPQEVMEEEENGVIKLTAPVEIGVGLSSRQLEKHRAVLEALLSEALPPPSLVFGGQRPVTAAWE
Length: 78(50-127)
Propeptide: MLSRKAVAALLLVHVTAMLASQTEGFVPIFTYSELRRTQEREQNKRLRKSLRVQQRSKAAGRLEPQEVMEEEENGVIKLTAPVEIGVGLSSRQLEKHRAVLEALLSEALPPPSLVFGGQRPVTAAWE
Signal peptide: MLSRKAVAALLLVHVTAMLASQTEG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
Kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002380_AF2.pdb

hor002380_ESM.pdb

Mass:	985932	Formula:	C373H616N108O115S
Absent amino acids:	CDY	Common amino acids:	EL
pI:	5.1	Basic residues:	10
Polar residues:	15	Hydrophobic residues:	30
Hydrophobicity:	-26.67	Boman Index:	-12648
Half-Life / Aliphatic Index:	1.9 hour	Aliphatic Index:	100
Instability Index:	6779.1	Extinction Coefficient cystines:	5500
Absorbance 280nm:	71.43